PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_023170_ocqo.t2
Common NameSOVF_023170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family MIKC_MADS
Protein Properties Length: 251aa    MW: 28666.4 Da    PI: 9.759
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_023170_ocqo.t2genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.13.7e-312776150
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                       krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+i+fss+g+lyey+
  Sp_023170_ocqo.t2 27 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYA 76
                       79***********************************************8 PP

2K-box103.72.4e-341001978100
              K-box   8 s.leeakaeslqqelakLkkeienLqreq....RhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                          ++ea+a+++qqe+akL+++i++  +++    Rh++Ge+L+sLs+keL++Le++Lek++++iRskKnell+++ie +qk+e el+++n+ L
  Sp_023170_ocqo.t2 100 GsVAEANAQYYQQEAAKLRNQIRTATENNrllsRHMMGEGLSSLSMKELKNLETKLEKGISRIRSKKNELLFAEIEFMQKREIELHNNNQFL 191
                        3499********************9966423338********************************************************** PP

              K-box  95 rkklee 100
                        r+++ e
  Sp_023170_ocqo.t2 192 RARISE 197
                        *99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.9921979IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-421978IPR002100Transcription factor, MADS-box
CDDcd002652.74E-432096No hitNo description
SuperFamilySSF554557.19E-322093IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-332141IPR002100Transcription factor, MADS-box
PROSITE patternPS0035002175IPR002100Transcription factor, MADS-box
PfamPF003192.3E-262875IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-334156IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-335677IPR002100Transcription factor, MADS-box
PfamPF014863.4E-23105195IPR002487Transcription factor, K-box
PROSITE profilePS5129713.906107201IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MDFPSQAMEE GSPSSQRKMG RGKIEIKRIE NTTNRQVTFC KRRNGLLKKA YELSVLCDAE  60
IALIVFSSRG RLYEYANQSC SVKGTIDRYK KACSDQTGAG SVAEANAQYY QQEAAKLRNQ  120
IRTATENNRL LSRHMMGEGL SSLSMKELKN LETKLEKGIS RIRSKKNELL FAEIEFMQKR  180
EIELHNNNQF LRARISENER AQQSMSLMPP GGSDYDLVPS QSFDSRNYFQ VNALQPNSQY  240
ARQDQTPLQL V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-201977159Myocyte-specific enhancer factor 2B
1tqe_Q1e-201977159Myocyte-specific enhancer factor 2B
1tqe_R1e-201977159Myocyte-specific enhancer factor 2B
1tqe_S1e-201977159Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6600070.0AY660007.1 Spinacia oleracea C class floral identity transcription factor AGAMOUS mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010687169.11e-178PREDICTED: floral homeotic protein AGAMOUS isoform X1
SwissprotQ408721e-131AG_PANGI; Floral homeotic protein AGAMOUS
TrEMBLA0A0K9RXS10.0A0A0K9RXS1_SPIOL; Uncharacterized protein
STRINGVIT_10s0003g02070.t011e-123(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.15e-98MIKC_MADS family protein